An official website of the United States government
A .gov website belongs to an official government organization in the United States.
A lock (lock ) or https:// means you’ve safely connected to the .gov website. Share sensitive information only on official, secure websites.


IFC Videos

Playlist:
No videos match your search criteria.
Playlist:
No videos match your search criteria.
Playlist:
Video by Staff Sgt. Christopher Jackson
U.S. Army Reserve Miltech Overview
U.S. Army Reserve Command
Feb. 9, 2023 | 0:54
Army Reserve military technicians are vital to mission success. Video highlighting benefits associated with serving as a USAR military technician.
More

Tags

servicebenefitsarmyreservearmynewswiremilitarytechnician
More

Up Next

Now Playing
U.S. Army Reserve Miltech Overview
U.S. Army Reserve Miltech Overview
More Videos
Multimedia (photography, video and audio) on the Department of Defense Non-Lethal Weapons Program website is cleared for public release and considered to be in the public domain. It is requested that credit be given to the individual author and Service whenever possible.